PDB entry 2mgm

View 2mgm on RCSB PDB site
Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1993-05-10, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.15
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2mgma_
  • Heterogens: SO4, HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mgmA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg