PDB entry 2mge

View 2mge on RCSB PDB site
Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin
Deposited on 1993-05-10, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2mge__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mge_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkklgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg