PDB entry 2mg4

View 2mg4 on RCSB PDB site
Description: Computational design and experimental verification of a symmetric protein homodimer
Class: de novo protein
Keywords: helix-turn-helix, DE NOVO PROTEIN
Deposited on 2013-10-26, released 2015-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Computational designed homodimer
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2MG4 (0-65)
    Domains in SCOPe 2.06: d2mg4a1, d2mg4a2
  • Chain 'B':
    Compound: Computational designed homodimer
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2MG4 (0-65)
    Domains in SCOPe 2.06: d2mg4b1, d2mg4b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mg4A (A:)
    mekrprtefseeqkkaldlafyfdrrltpewrrylsqrlglneeqierwfrrkeqqigws
    hpqfek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mg4B (B:)
    mekrprtefseeqkkaldlafyfdrrltpewrrylsqrlglneeqierwfrrkeqqigws
    hpqfek