PDB entry 2mfn

View 2mfn on RCSB PDB site
Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 10 structures
Deposited on 1998-02-11, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mfn_ (-)
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvsdiprdleviastptsllisweppavsvr
yyritygetggnspvqeftvpgskstatinnikpgadytitlyavtgrgdspasskpvsi
nykt