PDB entry 2mf2

View 2mf2 on RCSB PDB site
Description: Structural and biophysical characterization of the mRNA interferase SaMazF from Staphylococcus aureus.
Class: hydrolase
Keywords: CcdB/MazF fold, ribonuclease, HYDROLASE
Deposited on 2013-10-03, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA interferase MazF
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mazF, MW1992
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A0D7 (13-131)
      • expression tag (0-12)
    Domains in SCOPe 2.08: d2mf2a1, d2mf2a2
  • Chain 'B':
    Compound: mRNA interferase MazF
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mazF, MW1992
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7A0D7 (13-131)
      • expression tag (0-12)
    Domains in SCOPe 2.08: d2mf2b1, d2mf2b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mf2A (A:)
gsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitg
rinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmi
slglnavahqkn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mf2B (B:)
gsshhhhhhsqdpirrgdvyladlspvqgseqggvrpvviiqndtgnkysptvivaaitg
rinkakipthveiekkkykldkdsvilleqirtldkkrlkekltylsddkmkevdnalmi
slglnavahqkn