PDB entry 2mf0

View 2mf0 on RCSB PDB site
Description: Structural basis of the non-coding RNA RsmZ acting as protein sponge: Conformer L of RsmZ(1-72)/RsmE(dimer) 1to3 complex
Class: RNA binding protein/RNA
Keywords: Protein/RNA, non-coding RNA, translation repressor protein, Pseudomonas aeruginosa, messenger RNA, protein sequestration, two conformations, RNAse E cleave sites, homo-dimeric proteins, cooperativity, multiple protein binding sites, translation activation, ribosome binding site, large solution structure, electron paramagnetic resonance, protein sponge, RNP assembly, RNA BINDING PROTEIN-RNA complex
Deposited on 2013-10-02, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas protegens Pf-5 [TaxId:220664]
    Gene: rsmE, csrA, PFL_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mf0a_
  • Chain 'B':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas protegens Pf-5 [TaxId:220664]
    Gene: rsmE, csrA, PFL_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mf0b_
  • Chain 'C':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas protegens Pf-5 [TaxId:220664]
    Gene: rsmE, csrA, PFL_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mf0c_
  • Chain 'D':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas protegens Pf-5 [TaxId:220664]
    Gene: rsmE, csrA, PFL_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mf0d_
  • Chain 'E':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas protegens Pf-5 [TaxId:220664]
    Gene: rsmE, csrA, PFL_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mf0e_
  • Chain 'F':
    Compound: carbon storage regulator homolog
    Species: Pseudomonas protegens Pf-5 [TaxId:220664]
    Gene: rsmE, csrA, PFL_2095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2mf0f_
  • Chain 'G':
    Compound: rna_(72-mer)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2mf0A (A:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapdk
    retphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mf0A (A:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2mf0B (B:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapdk
    retphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mf0B (B:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2mf0C (C:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapdk
    retphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mf0C (C:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2mf0D (D:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapdk
    retphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mf0D (D:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2mf0E (E:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapdk
    retphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mf0E (E:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2mf0F (F:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapdk
    retphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mf0F (F:)
    mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
    

  • Chain 'G':
    No sequence available.