PDB entry 2mev

View 2mev on RCSB PDB site
Description: structural refinement and analysis of mengo virus
Class: Virus
Keywords: CARDIO PICORNAVIRUS COAT PROTEIN, Icosahedral virus
Deposited on 1989-04-21, released 1990-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: mengo virus coat protein (subunit vp1)
    Species: Mengo virus [TaxId:12107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mev1_
  • Chain '2':
    Compound: mengo virus coat protein (subunit vp2)
    Species: Mengo virus [TaxId:12107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mev.1
  • Chain '3':
    Compound: mengo virus coat protein (subunit vp3)
    Species: Mengo virus [TaxId:12107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mev3_
  • Chain '4':
    Compound: mengo virus coat protein (subunit vp4)
    Species: Mengo virus [TaxId:12107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2mev.1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2mev1 (1:)
    gvenaekgvtentdatadfvaqpvylpenqtkvaffydrsspigafavksgslesgfapf
    snkacpnsviltpgpqfdpaydqlrpqrlteiwgngneetsevfplktkqdysfclfspf
    vyykcdlevtlsphtsgahgllvrwcptgtptkpttqvlhevsslsegrtpqvysagpgt
    snqisfvvpynsplsvlpavwynghkrfdntgdlgiapnsdfgtlffagtkpdikftvyl
    ryknmrvfcprptvffpwptsgdkidmtpragvlmle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mev1 (1:)
    gvenaekgvtentdatadfvaqpvylpenqtkvaffydrsspigafavksgslesgfapf
    snkacpnsviltpgpqfdpaydqlrpqrlteiwgngneetsevfplktkqdysfclfspf
    vyykcdlevtlsphtsgahgllvrwcptgtptkpttqvlhevsslsegrtpqvysagpgt
    snqisfvvpynsplsvlpavwynghkrfdntgdlgiapnsdfgtlffagtkpdikftvyl
    ryknmrvfcprptvffpwptsgdkidmt
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2mev2 (2:)
    dqnteemenlsdrvsqdtagntvtntqstvgrlvgygtvhdgehpascadtasekilave
    ryytfkvndwtstqkpfeyiriplphvlsgedggvfgatlrrhylvktgwrvqvqcnasq
    fhagsllvfmapeyptldvfamdnrwskdnlpngtrtqtnrkgpfamdhqnfwqwtlyph
    qflnlrtnttvdlevpyvniaptsswtqhaswtlviavvapltystgastslditasiqp
    vrpvfnglrhevlsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mev2 (2:)
    enlsdrvsqdtagntvtntqstvgrlvgygtvhdgehpascadtasekilaveryytfkv
    ndwtstqkpfeyiriplphvlsgedggvfgatlrrhylvktgwrvqvqcnasqfhagsll
    vfmapeyptldvfamdnrwskdnlpngtrtqtnrkgpfamdhqnfwqwtlyphqflnlrt
    nttvdlevpyvniaptsswtqhaswtlviavvapltystgastslditasiqpvrpvfng
    lrhevlsrq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mev3 (3:)
    spipvtirehagtwystlpdstvpiygktpvapanymvgeykdfleiaqiptfignkvpn
    avpyieasntavktqplavyqvtlscsclantflaalsrnfaqyrgslvytfvftgtamm
    kgkfliaytppgagkptsrdqamqatyaiwdlglnssysftvpfispthfrmvgtdqani
    tnvdgwvtvwqltpltyppgcptsakiltmvsagkdfslkmpispapwspq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >2mev4 (4:)
    gnstssdknnsssegnegviinnfysnqyqnsidlsanatgsdppktygqfsnllsgavn
    afsnmlplla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2mev4 (4:)
    segnegviinnfysnqyqnsidlsanatgsdppktygqfsnllsgavnafsnmlplla