PDB entry 2mel

View 2mel on RCSB PDB site
Description: NMR solution structure of the GS-TAMAPIN MUTATION R7A
Class: toxin
Keywords: Scorpion toxin, tamapin, alpha KTx5.4 mutant R7A, toxin
Deposited on 2013-09-24, released 2014-05-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 5.4
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59869 (2-32)
      • expression tag (0-1)
      • engineered mutation (8)
    Domains in SCOPe 2.05: d2mela_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2melA (A:)
    gsafcnlracelscrslgllgkcigeeckcvpy