PDB entry 2meg

View 2meg on RCSB PDB site
Description: changes in conformational stability of a series of mutant human lysozymes at constant positions.
Class: hydroase
Keywords: enzyme, hydrolase, o-glycosyl, alpha + beta, glycosidase, hydroase
Deposited on 1998-05-02, released 1998-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • engineered (58)
  Domains in SCOPe 2.07: d2mega_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2megA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqsn
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv