PDB entry 2me6

View 2me6 on RCSB PDB site
Description: NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens in complex with the DNA sequence CGACTAATTAGTCG
Class: transcription/DNA
Keywords: DNA binding, TRANSCRIPTION, TRANSCRIPTION-DNA complex
Deposited on 2013-09-23, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein GBX-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14549 (1-70)
      • expression tag (0)
    Domains in SCOPe 2.06: d2me6a1, d2me6a2
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*ap*cp*tp*ap*ap*tp*tp*ap*gp*tp*cp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*ap*cp*tp*ap*ap*tp*tp*ap*gp*tp*cp*g)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2me6A (A:)
    sapggksrrrrtaftseqllelekefhckkylsltersqiahalklsevqvkiwfqnrra
    kwkrikagnvs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.