PDB entry 2mdx

View 2mdx on RCSB PDB site
Description: Solution structure of the human wild type FAPP1-PH domain
Class: membrane protein
Keywords: pleckstrin homology, phosphoinositide, MEMBRANE PROTEIN
Deposited on 2013-09-19, released 2014-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family A member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHA3, FAPP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HB20 (8-107)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2mdxa1, d2mdxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mdxA (A:)
    gplgspefmegvlykwtnyltgwqprwfvldngilsyydsqddvckgskgsikmavceik
    vhsadntrmeliipgeqhfymkavnaaerqrwlvalgsskacltdtrt