PDB entry 2md9

View 2md9 on RCSB PDB site
Description: Solution Structure of an Active Site Mutant Pepitdyl Carrier Protein
Class: ligase
Keywords: Protein, Carrier Protein, ligase
Deposited on 2013-09-06, released 2014-04-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrocidine synthase 3
    Species: Brevibacillus parabrevis [TaxId:54914]
    Gene: TYCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30409 (0-81)
      • engineered mutation (43)
      • cloning artifact (82-83)
      • expression tag (84-89)
    Domains in SCOPe 2.08: d2md9a1, d2md9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2md9A (A:)
    pvteaqyvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqv
    elplkvlfaqptikalaqyvatrshhhhhh