PDB entry 2md8

View 2md8 on RCSB PDB site
Description: NMR structure of Sp140 PHD finger cis conformer
Class: transcription
Keywords: PHD finger, TRANSCRIPTION
Deposited on 2013-09-02, released 2013-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Nuclear body protein SP140
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13342 (4-55)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2md8c1, d2md8c2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2md8C (C:)
gamgmrnldecevcrdggelfccdtcsrvfhedchippveaertpwncifcrmkes