PDB entry 2mcp

View 2mcp on RCSB PDB site
Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1984-10-15, released 1985-01-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.185
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: iga-kappa mcpc603 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2mcph1, d2mcph2
  • Chain 'L':
    Compound: iga-kappa mcpc603 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA72671 (0-219)
      • conflict (111)
    Domains in SCOPe 2.04: d2mcpl1, d2mcpl2
  • Heterogens: PC

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mcpH (H:)
    evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
    eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
    ssesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppala
    sggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mcpL (L:)
    divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec