PDB entry 2mcp

View 2mcp on RCSB PDB site
Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution
Deposited on 1984-10-15, released 1985-01-02
The last revision prior to the SCOP 1.69 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.1 Å
R-factor: 0.185
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mcpH (H:)
    evklvesggglvqpggslrlscatsgftfsdfymewvrqppgkrlewiaasrnkgnkytt
    eysasvkgrfivsrdtsqsilylqmnalraedtaiyycarnyygstwyfdvwgagttvtv
    ssesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppala
    sggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mcpL (L:)
    divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec