PDB entry 2mbw

View 2mbw on RCSB PDB site
Description: recombinant sperm whale myoglobin (met)
Deposited on 1996-06-20, released 1996-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2mbw__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mbw_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg