PDB entry 2mbf

View 2mbf on RCSB PDB site
Description: Solution structure of the forkhead domain of Brugia malayi DAF-16a
Class: transcription
Keywords: forkhead, FOXO, FOXO3a, winged helix, insulin/IGF-1 signaling, filarial parasites, TRANSCRIPTION
Deposited on 2013-07-30, released 2013-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fork head domain containing protein
    Species: Brugia malayi [TaxId:6279]
    Gene: Bm1_50095
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2mbfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2mbfA (A:)
npwgaesysdliakalkstfdgrmrlneiynwfasnvpyfgnrtsqeqsagwknsirhnl
slhsrfmriqnegagksswwvinpdakpgrnprrqrsatle