PDB entry 2mbe

View 2mbe on RCSB PDB site
Description: Backbone 1H and 15N Chemical Shift Assignments for the first domain of FAT10
Class: protein binding
Keywords: fat10, protein binding
Deposited on 2013-07-30, released 2014-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin D
  Species: Homo sapiens [TaxId:9606]
  Gene: UBD, FAT10
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15205 (0-74)
    • conflict (23)
  Domains in SCOPe 2.08: d2mbea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mbeA (A:)
  lcvhvrseewdlmtfdanpydsvlkikehvrsktkvpvqdqvlllgskilkprrslssyg
  idkektihltlkvvk