PDB entry 2mbc

View 2mbc on RCSB PDB site
Description: Solution Structure of human holo-PRL-3 in complex with vanadate
Class: hydrolase
Keywords: holo-PRL-3, vanadate, HYDROLASE
Deposited on 2013-07-29, released 2013-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine phosphatase type IVA 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP4A3, PRL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2mbca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mbcA (A:)
    marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek
    dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali
    esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkd