PDB entry 2mb5

View 2mb5 on RCSB PDB site
Description: hydration in protein crystals. a neutron diffraction analysis of carbonmonoxymyoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1989-10-11, released 1991-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 1995-07-20, with a file datestamp of 2007-06-04.
Experiment type: NEUT
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOP 1.75: d2mb5a_
• Heterogens: SO4, ND4, HEM, CMO, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mb5A (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg