PDB entry 2mb5

View 2mb5 on RCSB PDB site
Description: hydration in protein crystals. a neutron diffraction analysis of carbonmonoxymyoglobin
Deposited on 1989-10-11, released 1991-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NEUT
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2mb5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mb5_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg