PDB entry 2mal

View 2mal on RCSB PDB site
Description: Solution structure of Lipid Transfer Protein from Lentil Lens Culinaris
Class: lipid transport
Keywords: plant lipid transfer protein, Lens Culinaris, LIPID TRANSPORT
Deposited on 2013-07-16, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-specific lipid-transfer protein 2
  Species: Lens culinaris [TaxId:3864]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0AT29 (0-92)
  Domains in SCOPe 2.07: d2mala_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2malA (A:)
  aiscgavtsdlspcltyltggpgpspqccggvkkllaaanttpdrqaacnclksaagsit
  klntnnaaalpgkcgvnipykistttncntvkf