PDB entry 2mad

View 2mad on RCSB PDB site
Description: the active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
Class: oxidoreductase(chnh2(d)-deaminating)
Keywords: oxidoreductase(chnh2(d)-deaminating)
Deposited on 1992-05-20, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: methylamine dehydrogenase (heavy subunit)
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2madh_
  • Chain 'L':
    Compound: methylamine dehydrogenase (light subunit)
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2madl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2madH (H:)
    ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
    ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
    fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
    yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
    isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
    tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
    gsgpqvlsvmnea
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2madL (L:)
    vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgka