PDB entry 2m9x

View 2m9x on RCSB PDB site
Description: Solution NMR Structure of Microtubule-associated serine/threonine-protein kinase 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9151A
Class: transferase
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, TRANSFERASE
Deposited on 2013-06-20, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Microtubule-associated serine/threonine-protein kinase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0973, MAST1, SAST
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y2H9 (11-111)
    • expression tag (0-10)
  Domains in SCOPe 2.07: d2m9xa1, d2m9xa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m9xA (A:)
  mghhhhhhshmpkataqmeeklrdftrayepdsvlpladgvlsfihhqiielardcltks
  rdglittvyfyelqenlekllqdayerseslevafvtqlvkklliiisrpar