PDB entry 2m9x

View 2m9x on RCSB PDB site
Description: Solution NMR Structure of Microtubule-associated serine/threonine-protein kinase 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9151A
Class: transferase
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, TRANSFERASE
Deposited on 2013-06-20, released 2013-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated serine/threonine-protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0973, MAST1, SAST
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H9 (11-111)
      • expression tag (0-10)
    Domains in SCOPe 2.04: d2m9xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m9xA (A:)
    mghhhhhhshmpkataqmeeklrdftrayepdsvlpladgvlsfihhqiielardcltks
    rdglittvyfyelqenlekllqdayerseslevafvtqlvkklliiisrpar