PDB entry 2m9a
View 2m9a on RCSB PDB site
Description: Solution NMR Structure of E3 ubiquitin-protein ligase ZFP91 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7784A
Class: metal binding protein
Keywords: PSI:Biology, C2H2, Hr7784A, PSI-Biology, Northeast Structural Genomics Consortium, NESG, METAL BINDING PROTEIN
Deposited on
2013-06-05, released
2013-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated
2013-07-24, with a file datestamp of
2013-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: E3 ubiquitin-protein ligase ZFP91
Species: Homo sapiens [TaxId:9606]
Gene: FKSG11, ZFP91, ZNF757
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2m9aa_ - Heterogens: ZN
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2m9aA (A:)
mghhhhhhshmrdyiceycarafksshnlavhrmihtgekplqceicgftcrqkaslnwh
mkkhdadsfyqfscnicgkkfekkdsvvahkakshpev
Sequence, based on observed residues (ATOM records): (download)
>2m9aA (A:)
hmrdyiceycarafksshnlavhrmihtgekplqceicgftcrqkaslnwhmkkhdadsf
yqfscnicgkkfekkdsvvahkakshpev