PDB entry 2m9a

View 2m9a on RCSB PDB site
Description: Solution NMR Structure of E3 ubiquitin-protein ligase ZFP91 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7784A
Class: metal binding protein
Keywords: PSI:Biology, C2H2, Hr7784A, PSI-Biology, Northeast Structural Genomics Consortium, NESG, METAL BINDING PROTEIN
Deposited on 2013-06-05, released 2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase ZFP91
    Species: Homo sapiens [TaxId:9606]
    Gene: FKSG11, ZFP91, ZNF757
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96JP5 (11-97)
      • expression tag (9-10)
    Domains in SCOPe 2.08: d2m9aa1, d2m9aa2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2m9aA (A:)
    mghhhhhhshmrdyiceycarafksshnlavhrmihtgekplqceicgftcrqkaslnwh
    mkkhdadsfyqfscnicgkkfekkdsvvahkakshpev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m9aA (A:)
    hmrdyiceycarafksshnlavhrmihtgekplqceicgftcrqkaslnwhmkkhdadsf
    yqfscnicgkkfekkdsvvahkakshpev