PDB entry 2m8u

View 2m8u on RCSB PDB site
Description: Solution structure of the Dictyostelium discodieum Myosin Light Chain, MlcC
Class: contractile protein
Keywords: myosin light chain, helical bundle, CONTRACTILE PROTEIN
Deposited on 2013-05-28, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myosin Light Chain, MlcC
  Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
  Gene: DDB_G0289563
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q54HC2 (3-76)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d2m8ua1, d2m8ua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m8uA (A:)
  gshmnhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqn
  sgyvqyetfvgmlflwd