PDB entry 2m87

View 2m87 on RCSB PDB site
Description: Structural Basis of DNA Recognition by the Effector Domain of Klebsiella pneumoniae PmrA
Class: signaling protein
Keywords: PmrA, two-component signaling system, effector domain, DNA-binding, SIGNALING PROTEIN
Deposited on 2013-05-07, released 2014-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein basR/pmrA
    Species: Klebsiella pneumoniae [TaxId:1185418]
    Gene: BN18_3635
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m87a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m87A (A:)
nqgdneisvgnlrlnvtrrlvwlgetaldltpkeyallsrlmmkagspvhreilyndiys
wdnepatntlevhihnlrekigksrirtvrgfgymlannidte