PDB entry 2m6r

View 2m6r on RCSB PDB site
Description: apo_YqcA
Class: electron transport
Keywords: alpha/beta/alpha sandwich fold, ELECTRON TRANSPORT
Deposited on 2013-04-09, released 2014-04-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: yqcA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2m6ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m6rA (A:)
    maeigifvgtmygnsllvaeeaeailtaqghkatvfedpelsdwlpyqdkyvlvvtsttg
    qgdlpdsivplfqgikdslgfqpnlrygvialgdssyvnfcnggkqfdallqeqsaqrvg
    emllidasenpepetesnpwvehwgtlls