PDB entry 2m5w

View 2m5w on RCSB PDB site
Description: NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
Class: RNA binding protein
Keywords: Lupus protein, La motif, RNA BINDING PROTEIN
Deposited on 2013-03-11, released 2014-03-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: DDB_0204655, DDB_G0281763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2m5wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m5wA (A:)
mseetstqilkqveyyfsdsnfprdkflrseaaknvdnyisidviasfnrmktistdlql
itealkkstrlqvsedgkmvrrldplpenid