PDB entry 2m5r

View 2m5r on RCSB PDB site
Description: Solution structure of holo-acyl carrier protein of Leishmania major
Class: lipid binding protein
Keywords: lipid binding protein
Deposited on 2013-03-07, released 2014-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Leishmania major [TaxId:5664]
    Gene: ACP, LMJF_27_0290
    Database cross-references and differences (RAF-indexed):
    • Uniprot E9AD06 (2-79)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2m5ra1, d2m5ra2
  • Heterogens: PNS

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m5rA (A:)
mndvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhda
ekiqsipdaveyiaqnpmak