PDB entry 2m5g

View 2m5g on RCSB PDB site
Description: Solution structure of FimA wt
Class: structural protein
Keywords: FimA, Pili, pilus, STRUCTURAL PROTEIN
Deposited on 2013-02-24, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type-1 fimbrial protein, A chain
    Species: Escherichia coli [TaxId:83333]
    Gene: fimA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2m5ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m5gA (A:)
    aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
    cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
    ettlnngtntipfqaryfatgaatpgaanadatfkvqyq