PDB entry 2m5c

View 2m5c on RCSB PDB site
Description: Solution Structure of the Bacillus cereus Metallo-Beta-Lactamase BcII
Class: hydrolase
Keywords: BcII, Metallo-Beta-Lactamase, HYDROLASE
Deposited on 2013-02-20, released 2013-10-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase 2
    Species: Bacillus cereus [TaxId:1396]
    Gene: blm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2m5ca_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m5cA (A:)
sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk