PDB entry 2m56

View 2m56 on RCSB PDB site
Description: The structure of the complex of cytochrome P450cam and its electron donor putidaredoxin determined by paramagnetic NMR spectroscopy
Class: oxidoreductase/metal binding protein
Keywords: camphor, heme, iron-sulphor, lanthanide, paramagnetic, electron transfer, ferredoxin, OXIDOREDUCTASE-METAL BINDING PROTEIN complex
Deposited on 2013-02-14, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (0-403)
      • see remark 999 (265)
    Domains in SCOPe 2.07: d2m56a_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d2m56b_
  • Heterogens: HEM, CAM, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m56A (A:)
    laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
    ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
    iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
    mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
    dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
    qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
    lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m56B (B:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw