PDB entry 2m51

View 2m51 on RCSB PDB site
Description: NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
Class: protein binding
Keywords: SH3 domain of RAS GAP1, PROTEIN BINDING
Deposited on 2013-02-12, released 2013-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASA1, RASA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20936 (1-61)
      • leader sequence (0)
    Domains in SCOPe 2.06: d2m51a1, d2m51a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m51A (A:)
    grrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveev
    gr