PDB entry 2m4n

View 2m4n on RCSB PDB site
Description: Solution structure of the putative Ras interaction domain of AFD-1, isoform a from Caenorhabditis elegans
Class: unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, THIOREDOXIN-LIKE, New York Structural Genomics Research Consortium, NYSGRC, Assembly, Dynamics and Evolution of Cell-Cell and Cell-Matrix Adhesions, CELLMAT, PSI-Biology
Deposited on 2013-02-07, released 2013-03-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein AFD-1, isoform a
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: afd-1, W03F11.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BIC1 (1-107)
      • expression tag (0)
    Domains in SCOPe 2.04: d2m4na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m4nA (A:)
    smfggslkvyggeivptrpyvsilaeinenadrilgaalekyglehskddfilvevsndd
    drksmsdlreidgrpipptecplfemtarsgngengfdsflaikrkph