PDB entry 2m3z

View 2m3z on RCSB PDB site
Description: NMR solution structure of HIV-1 nucleocapsid protein in complex with an inhibitor displaying a 2 inhibitors:1 NC stoichiometry
Class: viral protein
Keywords: hiv-1 nc, viral protein
Deposited on 2013-01-28, released 2013-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleocapsid protein p7
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m3za_
  • Heterogens: ZN, 1HF

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m3zA (A:)
    iqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan