PDB entry 2m3w

View 2m3w on RCSB PDB site
Description: Protein structure determination from a set of 4D NOESY
Class: signaling protein
Keywords: non uniform sampling, 4D NOESY with diagonal suppression, calcium binding protein, S100A1 protein, SIGNALING PROTEIN
Deposited on 2013-01-28, released 2014-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (31)
    Domains in SCOPe 2.06: d2m3wa_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23297 (0-92)
      • engineered mutation (31)
    Domains in SCOPe 2.06: d2m3wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m3wA (A:)
    gseletametlinvfhahsgkegdkyklskkqlkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m3wB (B:)
    gseletametlinvfhahsgkegdkyklskkqlkellqtelsgfldaqkdvdavdkvmke
    ldengdgevdfqeyvvlvaaltvacnnffwens