PDB entry 2m3u

View 2m3u on RCSB PDB site
Description: Solution-state NMR structure of cataract-related human gamma(S)-crystallin point variant G18V
Class: structural protein
Keywords: gamma-S, eye lens, aggregation, crystallin, cataract, CRYGS, STRUCTURAL PROTEIN
Deposited on 2013-01-25, released 2013-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-crystallin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYGS, GRYG8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22914 (1-177)
      • expression tag (0)
      • engineered mutation (17)
    Domains in SCOPe 2.08: d2m3ua1, d2m3ua2, d2m3ua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m3uA (A:)
gsktgtkitfyedknfqvrrydcdcdcadfhtylsrcnsikveggtwavyerpnfagymy
ilpqgeypeyqrwmglndrlsscravhlpsggqykiqifekgdfsgqmyettedcpsime
qfhmreihsckvlegvwifyelpnyrgrqylldkkeyrkpidwgaaspavqsfrrive