PDB entry 2m2d

View 2m2d on RCSB PDB site
Description: Human programmed cell death 1 receptor
Class: apoptosis
Keywords: pd-1, apoptosis
Deposited on 2012-12-18, released 2013-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Programmed cell death protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: Pdcd1, Pd1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15116 (1-117)
    • expression tag (0)
    • conflict (60)
  Domains in SCOPe 2.05: d2m2da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m2dA (A:)
  mpptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd
  srfrvtqlpngrdfhmsvvrarrndsgtylcgaislapkaqikeslraelrvterrae