PDB entry 2m1u

View 2m1u on RCSB PDB site
Description: Solution structure of the small dictyostelium discoideium myosin light chain mlcb provides insights into iq-motif recognition of class i myosin myo1b
Class: contractile protein
Keywords: Myosin light chain, CONTRACTILE PROTEIN
Deposited on 2012-12-06, released 2013-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-18, with a file datestamp of 2015-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin light chain MlcB
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2M1U (0-92)
    Domains in SCOPe 2.08: d2m1ua1, d2m1ua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m1uA (A:)
    mgsshhhhhhssglvprgshmsdektqlieafynfdgdydgfvsveefrgiirdglpmte
    aeiteffeaadpnntgfidykafaamlysvdes