PDB entry 2m1k

View 2m1k on RCSB PDB site
Description: Interaction of Human S100A6 (C3S) with V domain of Receptor for Advanced Glycation End products (RAGE)
Class: protein binding
Keywords: S100A6 C3S, RAGE V, heterotetrameric, HADDOCK model, PROTEIN BINDING
Deposited on 2012-11-29, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Advanced glycosylation end product-specific receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AGER, RAGE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15109 (2-100)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Protein S100-A6
    Species: Homo sapiens [TaxId:9606]
    Gene: CACY, S100A6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06703 (Start-89)
      • engineered mutation (2)
    Domains in SCOPe 2.06: d2m1kb_
  • Chain 'C':
    Compound: Advanced glycosylation end product-specific receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AGER, RAGE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15109 (2-100)
      • expression tag (0-1)
  • Chain 'D':
    Compound: Protein S100-A6
    Species: Homo sapiens [TaxId:9606]
    Gene: CACY, S100A6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06703 (Start-89)
      • engineered mutation (2)
    Domains in SCOPe 2.06: d2m1kd_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2m1kB (B:)
    maspldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedl
    drnkdqevnfqeyvtflgalaliynealkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m1kB (B:)
    aspldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
    rnkdqevnfqeyvtflgalaliynealkg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2m1kD (D:)
    maspldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedl
    drnkdqevnfqeyvtflgalaliynealkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m1kD (D:)
    aspldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
    rnkdqevnfqeyvtflgalaliynealkg