PDB entry 2m1i

View 2m1i on RCSB PDB site
Description: High resolution structure and dynamics of CsPinA parvulin at physiological temperature
Class: isomerase
Keywords: catalytic tetrad, side-chain hydrogen bonds, functional dynamics, 15N relaxation, NIMA-kinase, Pin1, cell cycle, low temperature, cis/trans isomerisation, ISOMERASE
Deposited on 2012-11-28, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Parvulin-like peptidyl-prolyl isomerase
  Species: Cenarchaeum symbiosum [TaxId:46770]
  Gene: pinA, CENSYa_1183
  Database cross-references and differences (RAF-indexed):
  • Uniprot O74049 (5-96)
    • expression tag (0-4)
  Domains in SCOPe 2.07: d2m1ia1, d2m1ia2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m1iA (A:)
  gpmgsmadkikcshilvkkqgealavqerlkagekfgklakelsidggsakrdgslgyfg
  rgkmvkpfedaafrlqvgevsepvksefgyhvikrlg