PDB entry 2m17

View 2m17 on RCSB PDB site
Description: ubiquitin-like domain-containing C-terminal domain phosphatase (UBLCP1)
Class: hydrolase
Keywords: ubiquitin-like domain-containing C-terminal domain phosphatase (UBLCP1), HYDROLASE
Deposited on 2012-11-19, released 2013-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like domain-containing CTD phosphatase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLCP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m17a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m17A (A:)
malpiivkwggqeysvttlseddtvldlkqflktltgvlperqkllglkvkgkpaendvk
lgalklkpntkimmmgtrees