PDB entry 2m0t

View 2m0t on RCSB PDB site
Description: Structural characterization of the extended PDZ1 domain from NHERF1
Class: protein binding
Keywords: PDZ domain, PROTEIN BINDING
Deposited on 2012-11-06, released 2013-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF1
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC9A3R1, NHERF, NHERF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14745 (7-116)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d2m0ta1, d2m0ta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m0tA (A:)
    gidpftmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevn
    genvekethqqvvsriraalnavrllvvdpetdeqlqklgvqvreellraqeapgqa