PDB entry 2m0r

View 2m0r on RCSB PDB site
Description: Solution structure and dynamics of human S100A14
Class: metal binding protein
Keywords: EF-hand proteins, Protein dynamics, METAL BINDING PROTEIN
Deposited on 2012-11-05, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A14
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A14, S100A15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2m0ra_
  • Chain 'B':
    Compound: Protein S100-A14
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A14, S100A15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2m0rb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m0rA (A:)
    mgqcrsanaedaqefsdveraietliknfhqysveggketltpselrdlvtqqlphlmps
    ncgleekianlgscndsklefrsfweligeaaksvklerpvrgh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m0rB (B:)
    mgqcrsanaedaqefsdveraietliknfhqysveggketltpselrdlvtqqlphlmps
    ncgleekianlgscndsklefrsfweligeaaksvklerpvrgh