PDB entry 2m0r

View 2m0r on RCSB PDB site
Description: Solution structure and dynamics of human S100A14
Class: metal binding protein
Keywords: EF-hand proteins, Protein dynamics, METAL BINDING PROTEIN
Deposited on 2012-11-05, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein S100-A14
  Species: Homo sapiens [TaxId:9606]
  Gene: S100A14, S100A15
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HCY8
  Domains in SCOPe 2.07: d2m0ra_
• Chain 'B':
  Compound: Protein S100-A14
  Species: Homo sapiens [TaxId:9606]
  Gene: S100A14, S100A15
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HCY8 (0-103)
  Domains in SCOPe 2.07: d2m0rb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m0rA (A:)
  mgqcrsanaedaqefsdveraietliknfhqysveggketltpselrdlvtqqlphlmps
  ncgleekianlgscndsklefrsfweligeaaksvklerpvrgh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m0rB (B:)
  mgqcrsanaedaqefsdveraietliknfhqysveggketltpselrdlvtqqlphlmps
  ncgleekianlgscndsklefrsfweligeaaksvklerpvrgh