PDB entry 2m0p

View 2m0p on RCSB PDB site
Description: Solution structure of the tenth complement type repeat of human megalin
Class: lipid binding protein
Keywords: Complement type repeat, receptor, megalin, ldl receptor family, lrp2, LIPID BINDING PROTEIN
Deposited on 2012-11-01, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Low-density lipoprotein receptor-related protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: LRP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98164 (0-45)
  Domains in SCOPe 2.07: d2m0pa_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2m0pA (A:)
  thapascldtqytcdnhqcisknwvcdtdndcgdgsdekncnstethhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2m0pA (A:)
  thapascldtqytcdnhqcisknwvcdtdndcgdgsdekncnstet