PDB entry 2m0p

View 2m0p on RCSB PDB site
Description: Solution structure of the tenth complement type repeat of human megalin
Class: lipid binding protein
Keywords: Complement type repeat, receptor, megalin, ldl receptor family, lrp2, LIPID BINDING PROTEIN
Deposited on 2012-11-01, released 2013-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low-density lipoprotein receptor-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LRP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m0pa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2m0pA (A:)
    thapascldtqytcdnhqcisknwvcdtdndcgdgsdekncnstethhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2m0pA (A:)
    thapascldtqytcdnhqcisknwvcdtdndcgdgsdekncnstet