PDB entry 2m05

View 2m05 on RCSB PDB site
Description: Structure of module 2 from the E1 domain of C. elegans APL-1
Class: unknown function
Keywords: Apl-1, Amyloid Precursor Protein, UNKNOWN FUNCTION
Deposited on 2012-10-20, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-amyloid-like protein
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: apl-1, C42D8.8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q10651 (2-64)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d2m05a1, d2m05a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m05A (A:)
  eacqfshvnsrdqcndyqhwkdeagkqcktkkskgnkdmivrsfavlepcaldmftgvef
  vccpn